Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NAP1L2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	NAP1L2
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15702420 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15702420UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP157024 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP157024	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

NAP1L2 Polyclonal specifically detects NAP1L2 in Human samples. It is validated for Western Blot.

Specifications

Antigen	NAP1L2
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Stem Cell Markers
Gene Alias	BPXMGC26243, brain specific gene BPX, Brain-specific protein, X-linked, nucleosome assembly protein 1-like 2
Gene Symbols	NAP1L2
Isotype	IgG

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	P51860
Gene ID (Entrez)	4674
Immunogen	Synthetic peptides corresponding to NAP1L2 (nucleosome assembly protein 1-like 2) The peptide sequence was selected from the middle region of NAP1L2. Peptide sequence VDTLTPLIKKYDEPILKLLTDIKVKLSDPGEPLSFTLEFHFKPNEYFKNE.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

NAP1L2 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents