Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Nardilysin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Nardilysin |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Nardilysin Polyclonal specifically detects Nardilysin in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
Nardilysin | |
Polyclonal | |
Rabbit | |
Neuroscience | |
EC 3.4.24, EC 3.4.24.61, hNRD1, hNRD2, nardilysin, nardilysin (N-arginine dibasic convertase), N-arginine dibasic convertase, NRD convertase, NRD-C | |
NRDC | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
4898 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LVNWFKAHRGPGSKMLSVHVVGYGKYELEEDGTPSSEDSNSSCEVMQLTYLPTSPLLADCIIPITDIRAFT | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title