Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NAT13 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$353.00 - $573.00
Specifications
Antigen | NAT13 |
---|---|
Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
NAT13 Polyclonal antibody specifically detects NAT13 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
NAT13 | |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Cell Biology | |
PBS, pH 7.2, 40% glycerol | |
80218 | |
IgG | |
Affinity purified |
Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Polyclonal | |
Purified | |
RUO | |
Human | |
EC 2.3.1.-, FLJ13194, hSAN, Mak3 homolog (S. cerevisiae), N(alpha)-acetyltransferase 50, NatE catalytic subunit, N-acetyltransferase 13 (GCN5-related), N-acetyltransferase 5, N-acetyltransferase san homolog, NAT13San, NAT5SAN, NatE catalytic subunit, separation anxiety | |
This antibody was developed against Recombinant Protein corresponding to amino acids: MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYF | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title