NAT2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159905

Catalog No. NBP159905

Description

NAT2 Polyclonal specifically detects NAT2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NAT2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: NAT2
• Immunogen: Synthetic peptides corresponding to NAT2(N-acetyltransferase 2 (arylamine N-acetyltransferase)) The peptide sequence was selected from the middle region of NAT2. Peptide sequence CLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPRTIE.
• Quantity: 100 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 10
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: AAC2N-acetyltransferase type 2, Arylamide acetylase 2, arylamine N-acetyltransferase 2, EC 2.3.1.5, N-acetyltransferase 2 (arylamine N-acetyltransferase), NAT-2, PNAT, Polymorphic arylamine N-acetyltransferase
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Antibody reacts with both NAT1 and NAT2
• Target Species: Human
• Form: Purified