Learn More
Description
Specifications
Specifications
| Antigen | NCAPH2 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | CAP-H2, CAP-H2 subunit of the condensin II complex, CAPH2,384D8-2, Chromosome-associated protein H2, condensin-2 complex subunit H2, hCAP-H2, kleisin beta, Kleisin-beta, MGC15858, MGC18000, MGC2455, MGC4133, MGC5305, MGC8640, Non-SMC condensin II complex subunit H2, non-SMC condensin II complex, subunit H2 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human NCAPH2 (NP_689512). Peptide sequence EYLYSLVYQALDFISGKRRAKQLSSVQEDRANGVASSGVPQEAENEFLSL |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
