Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NCF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | NCF1 |
---|---|
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
NCF1 Polyclonal specifically detects NCF1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
NCF1 | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
47 kDa neutrophil oxidase factor, FLJ79451, NADPH oxidase organizer 2, NCF-1, NCF1A, neutrophil cytosol factor 1,47 kDa autosomal chronic granulomatous disease protein, neutrophil cytosolic factor 1, neutrophil cytosolic factor 1 (47kD, chronic granulomatous disease, autosomal1), neutrophil cytosolic factor 1, (chronic granulomatous disease, autosomal 1), Neutrophil NADPH oxidase factor 1, Nox organizer 2, NOXO2NCF-47K, Nox-organizing protein 2, p47phox, SH3 and PX domain-containing protein 1A, SH3PXD1Ap47-phox | |
NCF1 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Polyclonal | |
Rabbit | |
Human | |
P14598 | |
653361 | |
This antibody was developed against a recombinant protein corresponding to amino acids: SGWWFCQMKAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDG | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title