Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NCOA4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP23904825UL
Description
NCOA4 Polyclonal specifically detects NCOA4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
NCOA4 | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Q13772 | |
NCOA4 | |
This antibody was developed against a recombinant protein corresponding to amino acids: KSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQ | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
Androgen receptor coactivator 70 kDa protein, Androgen receptor-associated protein of 70 kDa, ARA70RFGret fused, DKFZp762E1112, ELE1NCoA-4, nuclear receptor coactivator 4,70 kDa AR-activator, PTC3RET-activating gene ELE1, Ret-activating protein ELE1,70 kDa androgen receptor coactivator | |
Rabbit | |
Affinity Purified | |
RUO | |
8031 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction