Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NCOA6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18919325UL
Description
NCOA6 Polyclonal specifically detects NCOA6 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
NCOA6 | |
Polyclonal | |
Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Q14686 | |
NCOA6 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:NQNVQHAGGQGAGPPQNQMQVSHGPPNMMQPSLMGIHGNMNNQQAGTSGVPQVNLSNMQGQPQQGPPSQLMGMHQQIVPSQGQMVQQQGTLNPQNPMILSRAQLMPQGQMMVNPPSQNLGPSPQRMTPPKQ | |
25 μL | |
Apoptosis, Cancer, Cell Cycle and Replication, DNA Repair, Transcription Factors and Regulators, Tumor Suppressors | |
23054 | |
Human | |
IgG |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
Activating signal cointegrator 2, AIB3NRC RAP250, Amplified in breast cancer protein 3, ASC-2, Cancer-amplified transcriptional coactivator ASC-2, KIAA0181PPAR-interacting protein, NRCamplified in breast cancer-3 protein, nuclear receptor coactivator 6, Nuclear receptor coactivator RAP250, Nuclear receptor-activating protein, 250 kDa, peroxisome proliferator-activated receptor interacting protein, PRIPPeroxisome proliferator-activated receptor-interacting protein, RAP250Thyroid hormone receptor-binding protein, thyroid hormone receptor binding protein, TRBPASC2activating signal cointegrator-2 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction