Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NCOA7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
$337.75 - $627.50
Specifications
| Antigen | NCOA7 |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
NCOA7 Polyclonal specifically detects NCOA7 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| NCOA7 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 135112 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:HGSPTVTKLSKEPSDTSAAFESTAKENFLGEDDDFVDLEELSSQTGGGMHKKDTLKECLSLDPEERKKAESQINNSAVEMQVQS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse | |
| 140 kDa estrogen receptor-associated protein, dJ187J11.3, ERAP140Nbla00052, ESNA1, Estrogen nuclear receptor coactivator 1, estrogen receptor associated protein 140 kDa, FLJ45605, MGC88425, Nbla10993, nuclear receptor coactivator 7, putative protein product of Nbla00052, putative protein product of Nbla10993 | |
| NCOA7 | |
| IgG | |
| Affinity Purified | |
| Specificity of human NCOA7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title