Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NCRNA00114 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP170648
Description
NCRNA00114 Polyclonal specifically detects NCRNA00114 in Human samples. It is validated for Western Blot.Specifications
NCRNA00114 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
C21orf24, long intergenic non-protein coding RNA 114, NCRNA00114 | |
Rabbit | |
Affinity Purified | |
RUO | |
400866 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
LINC00114 | |
Synthetic peptides corresponding to NCRNA00114 The peptide sequence was selected from the N terminal of NCRNA00114. Peptide sequence SFSKMRTGWRGAIPLRWRNRARNREKPHSPRAVSSPATHSLPPSNPCRLT. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Human: 100%;. | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title