Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NDFIP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | NDFIP2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15699020
|
Novus Biologicals
NBP15699020UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP156990
|
Novus Biologicals
NBP156990 |
100 μL |
Each for $487.50
|
|
|||||
Description
NDFIP2 Polyclonal specifically detects NDFIP2 in Human samples. It is validated for Western Blot.Specifications
| NDFIP2 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| FLJ25842, KIAA1165N4WBP5APutative MAPK-activating protein PM04/PM05/PM06/PM07, MAPK-activating protein PM04 PM05 PM06 PM07, N4wbp5a, Nedd4 family interacting protein 2, NEDD4 family-interacting protein 2, NEDD4 WW domain-binding protein 5A, NF-kappa-B-activating protein 413, Putative NF-kappa-B-activating protein 413 | |
| NDFIP2 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9NV92 | |
| 54602 | |
| Synthetic peptides corresponding to NDFIP2 (Nedd4 family interacting protein 2) The peptide sequence was selected from the middle region of NDFIP2. Peptide sequence SFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title