NDFIP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15699020UL

Catalog No. NBP15699020

Description

NDFIP2 Polyclonal specifically detects NDFIP2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NDFIP2
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: Q9NV92
• Gene Symbols: NDFIP2
• Immunogen: Synthetic peptides corresponding to NDFIP2 (Nedd4 family interacting protein 2) The peptide sequence was selected from the middle region of NDFIP2. Peptide sequence SFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFL.
• Quantity: 20 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 54602
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ25842, KIAA1165N4WBP5APutative MAPK-activating protein PM04/PM05/PM06/PM07, MAPK-activating protein PM04 PM05 PM06 PM07, N4wbp5a, Nedd4 family interacting protein 2, NEDD4 family-interacting protein 2, NEDD4 WW domain-binding protein 5A, NF-kappa-B-activating protein 413, Putative NF-kappa-B-activating protein 413
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG