NDUFA12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Catalog Number	Mfr. No.	Quantity
NB431017	Novus Biologicals NBP18893525UL	25 μL
NBP188935	Novus Biologicals NBP188935	0.1 mL

Description

NDUFA12 Polyclonal specifically detects NDUFA12 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NDUFA12
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: 13 kDa differentiation-associated protein, B17.2,13kDa differentiation-associated protein, CIB17.2, CI-B17.2, complex I B17.2 subunit, Complex I-B17.2, DAP13NADH-ubiquinone oxidoreductase subunit B17.2, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12, NADH: ubiquinone oxidoreductase
• Gene Symbols: NDUFA12
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 55967
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMN
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only