Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NB301445

NDUFAF4 Antibody, Novus Biologicals™
SDP

Catalog No. NB301445 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB301445 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB301445 Supplier Novus Biologicals Supplier No. NBP325007
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

NDUFAF4 Polyclonal antibody specifically detects NDUFAF4 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

Antigen NDUFAF4
Applications Immunocytochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias bA22L21.1, C6orf66chromosome 6 open reading frame 66, Hormone-regulated proliferation-associated protein of 20 kDa, hormone-regulated proliferation-associated protein, 20 kDa, HRPAP20HSPC125, My013, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 4, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 4
Host Species Rabbit
Immunogen This antibody has been engineered to specifically recognize the recombinant protein NDUFAF4 using the following amino acid sequence: IKSIPKGKISIVEALTLLNNHKLFPETWTAEKIMQEYQLEQKDVNSLLKYFVTFEVEIFPPEDKKAIRSK
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cancer, Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 29078
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.