Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NDUFAF4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier: Novus Biologicals NBP325007

Catalog No. NB301445

$534.50 / Each of 1

Already have an account? Sign In to view your price. New here? Register with us today!

Qty

Add to Cart

Description

NDUFAF4 Polyclonal antibody specifically detects NDUFAF4 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

Antigen	NDUFAF4
Classification	Polyclonal
Dilution	Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Gene Alias	bA22L21.1, C6orf66chromosome 6 open reading frame 66, Hormone-regulated proliferation-associated protein of 20 kDa, hormone-regulated proliferation-associated protein, 20 kDa, HRPAP20HSPC125, My013, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 4, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 4
Immunogen	This antibody has been engineered to specifically recognize the recombinant protein NDUFAF4 using the following amino acid sequence: IKSIPKGKISIVEALTLLNNHKLFPETWTAEKIMQEYQLEQKDVNSLLKYFVTFEVEIFPPEDKKAIRSK
Quantity	100 μL
Research Discipline	Cancer, Endocrinology, Signal Transduction
Gene ID (Entrez)	29078
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Applications	Immunocytochemistry
Conjugate	Unconjugated
Formulation	PBS, pH 7.2, 40% glycerol
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Spot an opportunity for improvement?Share a Content Correction

NDUFAF4 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions