Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NDUFAF5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP287892
Description
NDUFAF5 Polyclonal specifically detects NDUFAF5 in Mouse samples. It is validated for Western Blot.Specifications
NDUFAF5 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
79133 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
bA526K24.2, C20orf7, chromosome 20 open reading frame 7, dJ842G6.1, EC 2.1.1, EC 2.1.1.-, FLJ22324, MGC90272, NADH dehydrogenase (ubiquinone) complex I, assembly factor 5, probable methyltransferase C20orf7, mitochondrial | |
The immunogen is a synthetic peptide directed towards the middle region of Mouse NDUFAF5. Peptide sequence: DTMLAAAAVYREMYRNEDGSIPATFQIYHMIGWKYHDSQARPAERGSAT The peptide sequence for this immunogen was taken from within the described region. | |
100 μL | |
Primary | |
Mouse | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction