Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NDUFC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP154760
Description
NDUFC1 Polyclonal specifically detects NDUFC1 in Human samples. It is validated for Western Blot.Specifications
NDUFC1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
complex I KFYI subunit, KFYI, MGC117464, MGC126847, MGC138266, NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 1, 6kDa, NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial, subcomplex unknown, 1 (6kD, KFYI) | |
Rabbit | |
9 kDa | |
100 μL | |
Primary | |
This product is specific to Subunit or Isoform: C1, mitochondrial. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
O43677 | |
NDUFC1 | |
Synthetic peptides corresponding to NDUFC1(NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 1, 6kDa) The peptide sequence was selected from the middle region of NDUFC1. Peptide sequence RSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYKRRNGL The peptide sequence for this immunogen was taken from within the described region. | |
Affinity purified | |
RUO | |
4717 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction