NDUFC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154760

Catalog No. NBP154760

Description

NDUFC1 Polyclonal specifically detects NDUFC1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NDUFC1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: complex I KFYI subunit, KFYI, MGC117464, MGC126847, MGC138266, NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 1, 6kDa, NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial, subcomplex unknown, 1 (6kD, KFYI)
• Host Species: Rabbit
• Molecular Weight of Antigen: 9 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: C1, mitochondrial.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O43677
• Gene Symbols: NDUFC1
• Immunogen: Synthetic peptides corresponding to NDUFC1(NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 1, 6kDa) The peptide sequence was selected from the middle region of NDUFC1. Peptide sequence RSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYKRRNGL The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4717
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.