NDUFC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15476020UL

Catalog No. NBP15476020

Description

NDUFC1 Polyclonal specifically detects NDUFC1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NDUFC1
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: O43677
• Gene Symbols: NDUFC1
• Immunogen: Synthetic peptides corresponding to NDUFC1(NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 1, 6kDa) The peptide sequence was selected from the middle region of NDUFC1. Peptide sequence RSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYKRR
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4717
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: complex I KFYI subunit, KFYI, MGC117464, MGC126847, MGC138266, NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 1, 6kDa, NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial, subcomplex unknown, 1 (6kD, KFYI)
• Host Species: Rabbit
• Molecular Weight of Antigen: 9 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: C1, mitochondrial.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.