NDUFV3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18562125UL

Catalog No. NB406471

Description

NDUFV3 Polyclonal specifically detects NDUFV3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NDUFV3
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: CI-10k, CI-9KD, complex I 10kDa subunit, complex I, mitochondrial respiratory chain, 10-kD subunit, Complex I-9kD, mitochondrial NADH oxidoreductase-like protein, NADH dehydrogenase (ubiquinone) flavoprotein 3 (10kD), NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa, NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial, NADH-ubiquinone oxidoreductase 9 kD subunit, NADH-ubiquinone oxidoreductase 9 kD subunit precursor, EC 1.6.5.310CI-9kD, NADH-ubiquinone oxidoreductase 9 kDa subunit, NADH-ubiquinone oxidoreductase flavoprotein 3, 10kD, Renal carcinoma antigen NY-REN-4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4731
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: NDUFV3
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:QEAQVFRGLASTVSLSAESGKSEKGQPQNSKKQSPPKKPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMP
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only