NECAB1 Antibody (CL0576), Novus Biologicals™

Mouse Monoclonal Antibody

Supplier:  Novus Biologicals NBP25294625UL

Catalog No. NB395339

Description

NECAB1 Monoclonal antibody specifically detects NECAB1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: NECAB1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Mouse
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 64168
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG2b

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Clone: CL0576
• Dilution: Western Blot 1 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: EF hand calcium binding protein 1, EFCBP1, EF-hand calcium binding protein 1, EF-hand calcium-binding protein 1, neuronal calcium binding protein, Neuronal calcium-binding protein 1, N-terminal EF-hand calcium binding protein 1, N-terminal EF-hand calcium-binding protein 1, STIP-1, synaptotagmin interacting protein 1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LLKETLNQLQSLQNSLECAMETTEEQTRQERQGPAKPEVLSIQWPGKRSSRRVQRHNSFSPNSP
• Quantity: 25 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified