Invitrogen™ Nectin 4 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595385

Catalog No. PIPA595385

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: MCF-7 whole cell, MM453 whole cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Nectin 4 (PVRL4) is a gene located on chromosome 1q23.3 that encodes a member of the nectin family of cellular adhesion molecules. These proteins are primarily involved in forming adherens junctions between epithelial cells, contributing to tissue integrity and maintenance in various tissues, including the skin, lungs, and mammary glands. Nectin 4 is highly expressed during embryonic development and is crucial for processes like tissue morphogenesis and repair. It acts as a ligand for the poliovirus receptor-related family and participates in cell signaling pathways that influence cell proliferation and survival. In the context of cancer, Nectin 4 is often upregulated, particularly in breast, ovarian, and lung cancers, where its expression is associated with tumor progression, metastasis, and poor prognosis. This makes Nectin 4 a potential target for therapeutic interventions and a candidate biomarker for cancer diagnosis and monitoring.

Specifications

• Antigen: Nectin 4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: NECTIN4
• Gene Alias: 1200017F15Rik; EDSS1; ig superfamily receptor LNIR; LNIR; nectin 4; nectin cell adhesion molecule 4; NECTIN4; Nectin-4; poliovirus receptor-related 4; poliovirus receptor-related protein 4; Processed poliovirus receptor-related protein 4; PRR4; Pvrl4; RGD1559826
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 81607
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: Q96NY8
• Gene Symbols: NECTIN4
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Nectin-4/PVRL4 (53-94aa FYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGL HVSPAY).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov