Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Nectin 4 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595385

Catalog No. PIPA595385


Only null left
Add to Cart

Description

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: MCF-7 whole cell, MM453 whole cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Nectin 4 (PVRL4) is a gene located on chromosome 1q23.3 that encodes a member of the nectin family of cellular adhesion molecules. These proteins are primarily involved in forming adherens junctions between epithelial cells, contributing to tissue integrity and maintenance in various tissues, including the skin, lungs, and mammary glands. Nectin 4 is highly expressed during embryonic development and is crucial for processes like tissue morphogenesis and repair. It acts as a ligand for the poliovirus receptor-related family and participates in cell signaling pathways that influence cell proliferation and survival. In the context of cancer, Nectin 4 is often upregulated, particularly in breast, ovarian, and lung cancers, where its expression is associated with tumor progression, metastasis, and poor prognosis. This makes Nectin 4 a potential target for therapeutic interventions and a candidate biomarker for cancer diagnosis and monitoring.
TRUSTED_SUSTAINABILITY
Specifications

Specifications

Nectin 4
Polyclonal
Unconjugated
NECTIN4
1200017F15Rik; EDSS1; ig superfamily receptor LNIR; LNIR; nectin 4; nectin cell adhesion molecule 4; NECTIN4; Nectin-4; poliovirus receptor-related 4; poliovirus receptor-related protein 4; Processed poliovirus receptor-related protein 4; PRR4; Pvrl4; RGD1559826
Rabbit
Affinity chromatography
RUO
81607
-20°C
Lyophilized
Western Blot
500 μg/mL
PBS with 5mg BSA and 0.05mg sodium azide
Q96NY8
NECTIN4
A synthetic peptide corresponding to a sequence at the N-terminus of human Nectin-4/PVRL4 (53-94aa FYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGL HVSPAY).
100 μg
Primary
Human
Antibody
IgG
Product Suggestions

Product Suggestions

Videos
Safety and Handling

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.