Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NEDD8 Activating Enzyme (APPBP1/UBA3) Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309381100UL
Description
NEDD8 Activating Enzyme (APPBP1/UBA3) Polyclonal specifically detects NEDD8 Activating Enzyme (APPBP1/UBA3) in Mouse samples. It is validated for Western Blot.Specifications
NEDD8 Activating Enzyme (APPBP1/UBA3) | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
A-116A10.1, amyloid beta precursor protein binding protein 1, amyloid beta precursor protein binding protein 1, 59kDa, Amyloid beta precursor protein-binding protein 1, 59 kDa, amyloid beta precursor protein-binding protein 1, 59kD, Amyloid protein-binding protein 1, APPBP1APP-BP1, NEDD8 activating enzyme E1 subunit 1, NEDD8-activating enzyme E1 regulatory subunit, NEDD8-activating enzyme E1 subunit, protooncogene protein 1, Proto-oncogene protein 1, ula-1 | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse NEDD8 Activating Enzyme (APPBP1/UBA3) (NP_659180). Peptide sequence ARALKEFVAKEGQGNLPVRGTIPDMIADSNKYIKLQNVYREKAKKDAAAV | |
100 μg | |
Apoptosis | |
8883 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Mouse | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction