Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA595403

Invitrogen™ NEDD8 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA595403
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA595403 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA595403 Supplier Invitrogen™ Supplier No. PA595403
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HepG2 whole cell, human MCF-7 whole cell, human RT4 whole cell, human PC-3 whole cell, rat brain tissue, rat thymus tissue, mouse brain tissue, mouse thymus tissue. IHC: human lung cancer tissue. ICC/IF: A431 cell. Flow: A431 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

NEDD8 is a ubiquitin-like protein which plays an important role in cell cycle control and embryogenesis. Covalent attachment to its substrates requires prior activation by the E1 complex UBE1C-APPBP1 and linkage to the E2 enzyme UBE2M. Attachment of NEDD8 to cullins activates their associated E3 ubiquitin ligase activity, and thus promotes polyubiquitination and proteasomal degradation of cyclins and other regulatory proteins.
TRUSTED_SUSTAINABILITY

Specifications

Antigen NEDD8
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene Nedd8
Gene Accession No. P29595, Q15843, Q71UE8
Gene Alias nedd8; NEDD-8; NEDD8 ubiquitin like modifier; nedd8.L; nedd8.S; neddylin; Neural precursor cell expressed developmentally down-regulated protein 8; neural precursor cell expressed, developmentally down-regulated 8; neural precursor cell expressed, developmentally down-regulated 8 L homeolog; neural precursor cell expressed, developmentally down-regulated 8 S homeolog; neural precursor cell expressed, developmentally down-regulated gene 8; neural precursor cell-expressed developmentally down-regulated; Rub1; si:zc14a17.5; ubiquitin; ubiquitin-like protein Nedd8; XELAEV_18007009mg
Gene Symbols Nedd8
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human NEDD8 (20-60aa TDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYK).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 18002, 25490, 4738
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.