NEDD9/CASL/HEF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NBP255071	Novus Biologicals NBP255071	100 μL
NB395190	Novus Biologicals NBP25507125UL	25 μL

Description

NEDD9/CASL/HEF1 Polyclonal specifically detects NEDD9/CASL/HEF1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: NEDD9/CASL/HEF1
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: Cas scaffolding protein family member 2, CAS2, CasL, CAS-LCASS2cas-like docking, CASLdJ49G10.2, CRK-associated substrate-related protein, dJ49G10.2 (Enhancer of Filamentation 1 (HEF1)), dJ761I2.1, dJ761I2.1 (enhancer of filamentation (HEF1)), enhancer of filamentation 1, hEF1, HEF1Crk-associated substrate related, NEDD-9, Neural precursor cell expressed developmentally down-regulated protein 9, neural precursor cell expressed, developmentally down-regulated 9, p105, Renal carcinoma antigen NY-REN-12
• Gene Symbols: NEDD9
• Isotype: IgG
• Purification Method: Affinity Purified

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 4739
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYNCDIPGAAEPVARRHQSLSPNHPPPQLGQSVGSQNDAYDVPRGVQFLEPPA
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only