Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NELF Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | NELF |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
NELF Polyclonal specifically detects NELF in Human samples. It is validated for Western Blot.Specifications
| NELF | |
| Polyclonal | |
| Rabbit | |
| Q6X4W1-2 | |
| 26012 | |
| IgG | |
| 60 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| nasal embryonic LHRH factorMGC125369, nasal embryonic luteinizing hormone-releasing hormone factor | |
| Synthetic peptides corresponding to NELF(nasal embryonic LHRH factor) The peptide sequence was selected from the N terminal of NELF. Peptide sequence GAAASRRRALRSEAMSSVAAKVRAARAFGEYLSQSHPENRNGADHLLADA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title