Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NELF-E Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | NELF-E |
---|---|
Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
NELF-E Polyclonal specifically detects NELF-E in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
NELF-E | |
Polyclonal | |
Rabbit | |
DNA replication Transcription Translation and Splicing | |
D6S45, negative elongation factor E, negative elongation factor polypeptide E, NELFE, NELF-ERDmajor histocompatibility complex gene RD, nuclear protein, RD RNA binding protein, RD RNA-binding protein, RDP, RNA-binding protein RD | |
RDBP | |
IgG | |
Affinity Purified |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
7936 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VYGEDMTPTLLRGAFSPFGNIIDLSMDPPRNCAFVTYEKMESADQAVAELNGTQVESVQLKVNIARKQPMLDAATGKSVWGSLAVQNSPKGCHRDKRTQIVYSDDVYKE | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title