Neprilysin-2/MMEL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159349

Catalog No. NBP159349

Description

Neprilysin-2/MMEL1 Polyclonal specifically detects Neprilysin-2/MMEL1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Neprilysin-2/MMEL1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: MMEL1
• Immunogen: Synthetic peptides corresponding to MMEL1(membrane metallo-endopeptidase-like 1) The peptide sequence was selected from the middle region of MMEL1. Peptide sequence EVVVYGIPYLQNLENIIDTYSARTIQNYLVWRLVLDRIGSLSQRFKDTRV.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rat: 100%; Bovine: 92%; Canine: 92%; Equine: 92%; Pig: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: EC 3.4.24, EC 3.4.24.11, MELL1, membrane metallo-endopeptidase-like 1, Membrane metallo-endopeptidase-like 2MGC119455, MGC119454, MMEL2, NEP2, NEP2(m), NEPIIMGC119456, Neprilysin II, Neprilysin-2, NL2NL1, SEP, soluble secreted endopeptidase, zinc metallopeptidase
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79258
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.