Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Neprilysin-2/MMEL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | Neprilysin-2/MMEL1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15934920
![]() |
Novus Biologicals
NBP15934920UL |
20 μL |
Each for $206.00
|
|
|||||
NBP159349
![]() |
Novus Biologicals
NBP159349 |
100 μL |
Each for $487.50
|
|
|||||
Description
Neprilysin-2/MMEL1 Polyclonal specifically detects Neprilysin-2/MMEL1 in Human samples. It is validated for Western Blot.Specifications
Neprilysin-2/MMEL1 | |
Polyclonal | |
Rabbit | |
EC 3.4.24, EC 3.4.24.11, MELL1, membrane metallo-endopeptidase-like 1, Membrane metallo-endopeptidase-like 2MGC119455, MGC119454, MMEL2, NEP2, NEP2(m), NEPIIMGC119456, Neprilysin II, Neprilysin-2, NL2NL1, SEP, soluble secreted endopeptidase, zinc metallopeptidase | |
MMEL1 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
79258 | |
Synthetic peptides corresponding to MMEL1(membrane metallo-endopeptidase-like 1) The peptide sequence was selected from the middle region of MMEL1. Peptide sequence EVVVYGIPYLQNLENIIDTYSARTIQNYLVWRLVLDRIGSLSQRFKDTRV. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title