Nesfatin-1/Nucleobindin-2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157952

Catalog No. NBP157952

Description

Nesfatin-1/Nucleobindin-2 Polyclonal antibody specifically detects Nesfatin-1/Nucleobindin-2 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).

Specifications

• Antigen: Nesfatin-1/Nucleobindin-2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DNA-binding protein NEFA, NEFAGastric cancer antigen Zg4, nucleobindin 2, nucleobindin-2, nucleobinding 2
• Host Species: Rabbit
• Molecular Weight of Antigen: 46 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 85%; Chicken: 78%; Guinea pig: 86%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: P80303
• Gene Symbols: NUCB2
• Immunogen: Synthetic peptides corresponding to NUCB2 (nucleobindin 2) The peptide sequence was selected from the middle region of NUCB2. Peptide sequence MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4925
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only