Novus Biologicals™ Nesprin-3 Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Supplier:  Novus Biologicals™ NBP257690PEP

Catalog No. NBP257690PE

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Nesprin-3. Source: E.coli Amino Acid Sequence: RVDLVLRMAEALLACCPGDQKPGILARLKDIKAQWEETVTYMTHCHSRIEWVWLHWSEYLLARDEFYRWFQKMMVTLEPHIELQLGLKEKQWQ The Nesprin-3 Recombinant Protein Antigen is derived from E. coli. The Nesprin-3 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 161176
• Common Name: Nesprin-3 Recombinant Protein Antigen
• Formulation: PBS and 1M Urea, pH 7.4
• Gene Alias: chromosome 14 open reading frame 49, FLJ25605, MGC75267, nesprin-3, NET53
• Label Type: Unlabeled
• Quantity: 100μL
• Source: E.coli

• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Symbol: SYNE3
• Product Type: Recombinant Protein Antigen
• Regulatory Status: RUO
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53599. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For research use only.