Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NET1 Antibody (CL3063), Novus Biologicals™

Mouse Monoclonal Antibody
Supplier: Novus Biologicals NBP24664825UL
Description
NET1 Monoclonal antibody specifically detects NET1 in Human, Mouse, Rat samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
NET1 | |
Monoclonal | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol | |
ARHGEF8neuroepithelial cell-transforming gene 1 protein, guanine nucleotide regulatory protein (oncogene), NET1A, neuroepithelial cell transforming 1, neuroepithelial cell transforming gene 1, neuroepithelioma transforming gene 1, p65 Net1 proto-oncogene protein, Proto-oncogene p65 Net1, Rho guanine nucleotide exchange factor (GEF) 8, Rho guanine nucleotide exchange factor 8, small GTP-binding protein regulator | |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SLYYLFSSFTLNLPWTDCGHTWNSPNCTDPKLLNGSVLGNHTKYSKYKFTPAAEFYERGVLHLHESSGIHDI | |
25 μL | |
Primary | |
Human, Mouse, Rat | |
Purified |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
CL3063 | |
Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
P23975 | |
Mouse | |
Protein A purified | |
RUO | |
10276 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG1 |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction