Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Netrin G2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP24965325UL
Description
Netrin G2 Polyclonal antibody specifically detects Netrin G2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
Netrin G2 | |
Polyclonal | |
Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
bA479K20.1, KIAA0625, KIAA1857bA479K20.1 (novel protein), laminet 2, laminet-2, LHLL9381, LMNT2, MGC21884, netrin G1, netrin G2, netrin-G2, NTNG1 | |
This antibody was developed against a recombinant protein corresponding to amino acids: KEEEGLATYWQSITWSRYPSPLEANITLSWNKTVELTDDVVMTFEYG | |
25 μL | |
Neuroscience | |
84628 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol | |
Rabbit | |
Immunogen affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction