Learn More
Description
Specifications
Specifications
| Antigen | Netrin G2 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Formulation | PBS (pH 7.2), 40% Glycerol |
| Gene Alias | bA479K20.1, KIAA0625, KIAA1857bA479K20.1 (novel protein), laminet 2, laminet-2, LHLL9381, LMNT2, MGC21884, netrin G1, netrin G2, netrin-G2, NTNG1 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KEEEGLATYWQSITWSRYPSPLEANITLSWNKTVELTDDVVMTFEYG |
| Purification Method | Immunogen affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
