Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Netrin G2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309395100UL
Description
Netrin G2 Polyclonal specifically detects Netrin G2 in Human samples. It is validated for Western Blot.Specifications
Netrin G2 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
bA479K20.1, KIAA0625, KIAA1857bA479K20.1 (novel protein), laminet 2, laminet-2, LHLL9381, LMNT2, MGC21884, netrin G1, netrin G2, netrin-G2, NTNG1 | |
The immunogen is a synthetic peptide directed towards the middle region of human Netrin G2 (NP_115925). Peptide sequence YSRWAGSKKEKHVRFEVRDRFAIFAGPDLRNMDNLYTRLESAKGLKEFFT | |
100 μg | |
Neuroscience | |
84628 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction