Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Neudesin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP21365225UL
Description
Neudesin Polyclonal specifically detects Neudesin in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
Neudesin | |
Polyclonal | |
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Cell immortalization-related protein 2, CIR2cell growth-inhibiting protein 47, NEUDESIN, neuron derived neurotrophic factor, Neuron-derived neurotrophic factor, SCIRP10, SCIRP10-related protein, Secreted protein of unknown function, Spinal cord injury related protein 10, SPUF protein, SPUFneudesin | |
Rabbit | |
Affinity Purified | |
RUO | |
29937 | |
Human | |
IgG |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
NENF | |
This antibody was developed against a recombinant protein corresponding to the amino acids: LDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIVGYTARRILNEDGSPNLDFKPEDQP | |
25ul | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction