Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Neurexophilin-3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Neurexophilin-3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Neurexophilin-3 Polyclonal specifically detects Neurexophilin-3 in Human samples. It is validated for Western Blot.Specifications
Neurexophilin-3 | |
Polyclonal | |
Rabbit | |
Neuroscience | |
KIAA1159, neurexophilin 3, NPH3neurexophilin-3 | |
NXPH3 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q9Z2N5 | |
11248 | |
Synthetic peptides corresponding to NXPH3 (neurexophilin 3) The peptide sequence was selected from the middle region of NXPH3. Peptide sequence NISISLVPPSKAVEFHQEQQIFIEAKASKIFNCRMEWEKVERGRRTSLCT. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title