NEURL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256809

Catalog No. NBP256809

Description

NEURL2 Polyclonal specifically detects NEURL2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: NEURL2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: C20orf163, chromosome 20 open reading frame 163, dJ337O18.6, FLJ30259, MGC125934, MGC125935, neuralized homolog 2 (Drosophila), neuralized-like 2, neuralized-like 2 (Drosophila), neuralized-like protein 2, OZZ, Ozz-E3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 140825
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: NEURL2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YELNVLPPTARRSRLGVLFCPRPDGTADMHIIINGEDMGPSARGLPAAQPLYAVVDVFASTKSVRLVQLEYGL
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only