Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Neuroglycan C/CSPG5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$337.75 - $627.50
Specifications
Antigen | Neuroglycan C/CSPG5 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Neuroglycan C/CSPG5 Polyclonal specifically detects Neuroglycan C/CSPG5 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
Neuroglycan C/CSPG5 | |
Polyclonal | |
Rabbit | |
Cellular Markers, Neuroscience | |
CALEB, chondroitin sulfate proteoglycan 5, chondroitin sulfate proteoglycan 5 (neuroglycan C), MGC44034, Neuroglycan C, NGCAcidic leucine-rich EGF-like domain-containing brain protein | |
CSPG5 | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
10675 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SLSTIAEGSHPNVRKLCNTPRTSSPHARALAHYDNVICQDDPSAPHKIQEVLKSCLKEEESFNIQNSMSPKLEGGKGDQADLDVNCL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title