Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Neuromedin BR/NMBR Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15902420UL
Description
Neuromedin BR/NMBR Polyclonal specifically detects Neuromedin BR/NMBR in Human samples. It is validated for Western Blot.Specifications
Neuromedin B R/NMBR | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
P28336 | |
NMBR | |
Synthetic peptides corresponding to NMBR(neuromedin B receptor) The peptide sequence was selected from the N terminal of NMBR. Peptide sequence PSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYL. | |
20 μL | |
GPCR | |
4829 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
neuromedin B receptor, neuromedin-B receptor, Neuromedin-B-preferring bombesin receptor, NMB-R | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction