Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Neuromedin BR/NMBR Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Applications | Western Blot |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15902420
|
Novus Biologicals
NBP15902420UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP159024
|
Novus Biologicals
NBP159024 |
100 μL |
Each for $487.50
|
|
|||||
Description
Neuromedin BR/NMBR Polyclonal specifically detects Neuromedin BR/NMBR in Human samples. It is validated for Western Blot.Specifications
| Western Blot | |
| Unconjugated | |
| RUO | |
| Human | |
| neuromedin B receptor, neuromedin-B receptor, Neuromedin-B-preferring bombesin receptor, NMB-R | |
| NMBR | |
| IgG |
| Polyclonal | |
| Rabbit | |
| GPCR | |
| P28336 | |
| 4829 | |
| Synthetic peptides corresponding to NMBR(neuromedin B receptor) The peptide sequence was selected from the N terminal of NMBR. Peptide sequence PSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title