Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Neuromedin UR1/NMUR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Neuromedin UR1/NMUR1 |
---|---|
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Neuromedin UR1/NMUR1 Polyclonal specifically detects Neuromedin UR1/NMUR1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Neuromedin UR1/NMUR1 | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
(FM-3), FM3, FM-3, G protein-coupled receptor 66, GPC-R, GPR66G-protein coupled receptor 66, G-protein coupled receptor FM-3, neuromedin U receptor 1, neuromedin-U receptor 1, NMU1R, NMU-R1 | |
NMUR1 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Polyclonal | |
Rabbit | |
GPCR | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
10316 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:TPLCLNCSVLPGDLYPGGARNPMACNGSAARGHFDPEDLNLTDEALRLKYLGPQQTELFMP | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title