Neuropilin-2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP18686625UL

Catalog No. NB431637

Description

Neuropilin-2 Polyclonal specifically detects Neuropilin-2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Neuropilin-2
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: O60462
• Gene Symbols: NRP2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYL
• Quantity: 25 μL
• Research Discipline: Angiogenesis, Cancer, Hypoxia
• Gene ID (Entrez): 8828
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: MGC126574, neuropilin 2, neuropilin-2, neuropilin-2a(22), neuropilin-2b(0), NP2, NPN 2, NPN2, PRO2714, receptor for VEGF165 and semaphorins class3, Vascular endothelial cell growth factor 165 receptor 2, vascular endothelial growth factor-165 receptor 2, VEGF1265R2, VEGF165R2neuropilin-2a(17)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only