Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Neuropilin-2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
Antigen | Neuropilin-2 |
---|---|
Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Neuropilin-2 Polyclonal specifically detects Neuropilin-2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
Neuropilin-2 | |
Polyclonal | |
Rabbit | |
Angiogenesis, Cancer, Hypoxia | |
MGC126574, neuropilin 2, neuropilin-2, neuropilin-2a(22), neuropilin-2b(0), NP2, NPN 2, NPN2, PRO2714, receptor for VEGF165 and semaphorins class3, Vascular endothelial cell growth factor 165 receptor 2, vascular endothelial growth factor-165 receptor 2, VEGF1265R2, VEGF165R2neuropilin-2a(17) | |
NRP2 | |
IgG | |
Affinity Purified |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
8828 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PSGFNCNFDFLEEPCGWMYDHAKWLRTTWASSSSPNDRTFPDDRNFLRLQSDSQREGQYARLISPPVHLPRSPVCMEFQY | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title