Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Neurotrimin/HNT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Neurotrimin/HNT |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Neurotrimin/HNT Polyclonal specifically detects Neurotrimin/HNT in Human samples. It is validated for Western Blot.Specifications
Neurotrimin/HNT | |
Polyclonal | |
Rabbit | |
NP_001137530 | |
50863 | |
The immunogen for this antibody is HNT - N-terminal region. Peptide sequence LSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKIVE. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
hNT, IgLON family member 2, IGLON2HNTNT, MGC60329, neurotrimin, NTRI | |
NTM | |
IgG | |
39 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title