Neurotrypsin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238231

Catalog No. NBP238231

Description

Neurotrypsin Polyclonal specifically detects Neurotrypsin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Neurotrypsin
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: P56730
• Gene Symbols: PRSS12
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: WVSVTDFGAPCLRWAEVPPFLERSPPASWAQLRGQRHNFCRSPDGAGRPWCFYGDARGKVDWGYCDCRHGSVRLRGGK
• Quantity: 0.1 mL
• Research Discipline: Vision
• Gene ID (Entrez): 8492
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: brain-specific serine protease 3, BSSP3, BSSP-3, EC 3.4.21, leydin, MGC12722, Motopsin, MRT1EC 3.4.21.-, neurotrypsin, protease, serine, 12 (neurotrypsin, motopsin), Serine protease 12
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.