Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NFATC2IP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | NFATC2IP |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
NFATC2IP Polyclonal specifically detects NFATC2IP in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
NFATC2IP | |
Polyclonal | |
Rabbit | |
Human | |
84901 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SPWKTKLRTKDKEEKKKTEFLDLDNSPLSPPSPRTKSRTHTRALKKLSEVNKRLQDLRSCLSPKPPQGQEQQGQEDEVVLVE | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
45 kDa NF-AT-interacting protein, ESC2, FLJ14639, MGC126790, MGC138387, NFATC2-interacting protein, NIP4545 kDa NFAT-interacting protein, Nuclear factor of activated T-cells, cytoplasmic 2-interacting protein, nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2interacting protein, RAD60 | |
NFATC2IP | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title