Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NFkB2/NFkB p100 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$646.00
Specifications
Antigen | NFkB2/NFkB p100 |
---|---|
Concentration | 0.2mg/mL |
Dilution | Western Blot 0.04-0.4 ug/ml, Simple Western 1:30, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000, Knockdown Validated |
Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown |
Classification | Polyclonal |
Description
NFkB2/NFkB p100 Polyclonal antibody specifically detects NFkB2/NFkB p100 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Knockdown.Specifications
NFkB2/NFkB p100 | |
Western Blot 0.04-0.4 ug/ml, Simple Western 1:30, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000, Knockdown Validated | |
Polyclonal | |
Rabbit | |
Apoptosis, Cancer, Cell Biology, Neurodegeneration, Neuroscience, Signal Transduction, Transcription Factors and Regulators | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
4791 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:LLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTEVKEDSAYGSQSVEQEA | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
0.2mg/mL | |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown | |
Unconjugated | |
RUO | |
Human, Mouse, Rat | |
DNA-binding factor KBF2, H2TF1, Lymphocyte translocation chromosome 10 protein, Lyt10, LYT10LYT-10, nuclear factor NF-kappa-B p100 subunit, nuclear factor of kappa light chain gene enhancer in B-cells 2, Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2, nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100), Oncogene Lyt-10, p52 | |
NFKB2 | |
IgG | |
Affinity Purified | |
Specificity of human NFkB2/NFkB p100 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title