Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NFKBID Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17985620UL
Description
NFKBID Polyclonal specifically detects NFKBID in Human samples. It is validated for Western Blot.Specifications
NFKBID | |
Polyclonal | |
Western Blot 1:1000 | |
NP_640332 | |
NFKBID | |
Synthetic peptide directed towards the C terminal of human NFKBIDThe immunogen for this antibody is NFKBID. Peptide sequence QARDRLDCVHMLLQMGANHTSQEIKSNKTVLHLAVQAANPTLVQLLLELP. | |
Affinity Purified | |
RUO | |
84807 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
delta, IkappaBdelta, I-kappa-B-delta, IkappaBNSikappaBdelta, ikB-delta, IKBNS, MGC11314, MGC149503, nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, TA-NFKBHNF-kappa-B inhibitor delta, T-cell activation NFKB-like protein | |
Rabbit | |
33 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction