Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NFKBID Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | NFKBID |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP17985620
![]() |
Novus Biologicals
NBP17985620UL |
20 μL |
Each for $206.00
|
|
|||||
NBP179856
![]() |
Novus Biologicals
NBP179856 |
100 μL |
Each for $487.50
|
|
|||||
Description
NFKBID Polyclonal specifically detects NFKBID in Human samples. It is validated for Western Blot.Specifications
NFKBID | |
Polyclonal | |
Rabbit | |
NP_640332 | |
84807 | |
Synthetic peptide directed towards the C terminal of human NFKBIDThe immunogen for this antibody is NFKBID. Peptide sequence QARDRLDCVHMLLQMGANHTSQEIKSNKTVLHLAVQAANPTLVQLLLELP. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
delta, IkappaBdelta, I-kappa-B-delta, IkappaBNSikappaBdelta, ikB-delta, IKBNS, MGC11314, MGC149503, nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, TA-NFKBHNF-kappa-B inhibitor delta, T-cell activation NFKB-like protein | |
NFKBID | |
IgG | |
33 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title