Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NGX6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	NGX6
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Form	Purified

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP160059 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP160059	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

NGX6 Polyclonal specifically detects NGX6 in Human samples. It is validated for Western Blot.

Specifications

Antigen	NGX6
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Gene Accession No.	Q5TCW5
Gene ID (Entrez)	51754
Immunogen	Synthetic peptides corresponding to NGX6 The peptide sequence was selected from the C terminal of NGX6. Peptide sequence FLLPPRAKTDHGVPSGARARGCGYQLCINEQEELGLVGPGGATVSSICAS.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Cell Cycle and Replication
Gene Alias	C9orf127, chromosome 9 open reading frame 127, NAG-5, nasopharyngeal carcinoma expressed 6, nasopharyngeal carcinoma related protein, Nasopharyngeal carcinoma-associated gene 6 protein, NGX6MGC120460, Protein NAG-5, Protein NGX6, RP11-112J3.10, transmembrane protein 8B
Gene Symbols	TMEM8B
Isotype	IgG
Purification Method	Protein A purified

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

NGX6 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents